PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g49987.1.p
Common NameBRADI_3g49987, LOC100830325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 287aa    MW: 30770.5 Da    PI: 6.943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g49987.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.7e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd+ lvd ++  G g+W++ ++  g++R++k+c++rw +yl
  Bradi3g49987.1.p 14 KGPWTLEEDKVLVDFIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding47.93.1e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T eE++ +v+++   G++ W+ Ia+ ++ gRt++++k++w+++l
  Bradi3g49987.1.p  67 RGAFTDEEQKSIVQLHGIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.474961IPR017930Myb domain
SuperFamilySSF466891.31E-2911108IPR009057Homeodomain-like
SMARTSM007174.4E-121363IPR001005SANT/Myb domain
PfamPF002494.5E-141461IPR001005SANT/Myb domain
CDDcd001671.47E-81661No hitNo description
PROSITE profilePS5129425.27862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2565116IPR009057Homeodomain-like
SMARTSM007179.5E-1466114IPR001005SANT/Myb domain
PfamPF002493.7E-1367112IPR001005SANT/Myb domain
CDDcd001671.30E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRAPCCDNK GLKKGPWTLE EDKVLVDFIQ ANGHGSWRLL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGAF TDEEQKSIVQ LHGIVGNKWS MIAAQLPGRT DNEIKNYWNT HLKKQLRRMG  120
LDEPPPGPTG GCPAARHMAQ WETARLEAEA RLSLLSSSAA AAAAATATTT TTTSGSAASS  180
SSSAAADSKP ADVFLRLWNS DIGSSFRKVE AGHGPPVSSA KEEAHDAVKP QGDESSSSEM  240
DAASAEYQMF LDFAGEELGL FHGRHGGFSL FPPLDVLSEA SLDTAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086211e-176AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569965.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLI1IC050.0I1IC05_BRADI; Uncharacterized protein
STRINGBRADI3G49987.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.16e-72myb domain protein 17